Recombinant Human HORMAD1 protein (ab164488)

Overview

  • Product name
    Recombinant Human HORMAD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATAQLQRTPMSALVFPNKISTEHQSLVLVKRLLAVSVSCITYLRGIFPE CAYGTRYLDDLCVKILREDKNCPGSTQLVKWMLGCYDALQKKYLRMVVLA VYTNPEDPQTISECYQFKFKYTNNGPLMDFISKNQSNESSMLSTDTKKAS ILLIRKIYILMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEG VIFEGEPMYLNVGEVSTPFHIFKVKVTTERERMENIDSTILSPKQIKTPF QKILRDKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDE IMRSKESPDLSISHSQVEQLVNKTSELDMSESKTRSGKVFQNKMANGNQP VKSSKENRKRSQHESGRIVLHHFDSSSQESVPKRRKFSEPKEHI
    • Amino acids
      1 to 394
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164488 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen CT46
    • CT46
    • HORMA domain containing 1
    • HORMA domain containing protein
    • HORMA domain containing protein 1
    • Newborn ovary HORMA protein
    • NOHMA
    • OTTHUMP00000032933
    • RP11-363I22 1
    • Testis tissue sperm binding protein Li 86P
    see all
  • Relevance
    HORMAD1 is a cancer/testis (CT) antigen; it is expressed strongly in testis, where it is increased in cancer and weakly in placenta. HORMAD1 shows homology to a yeast meiosis specific protein.
  • Cellular localization
    Nuclear

Images

  • ab164488 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164488 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164488.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up