Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49639
    • SpeciesHuman
    • SequenceEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQ IGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSP YALNQEADV
    • Molecular weight38 kDa including tags
    • Amino acids11 to 119

Specifications

Our Abpromise guarantee covers the use of ab114878 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BSAS
    • Homeo box A1
    • Homeobox 1F
    • Homeobox A1
    • Homeobox protein Hox A1
    • Homeobox protein Hox-1F
    • Homeobox protein Hox-A1
    • Hox 1.6 like protein
    • Hox 1F
    • HOX A1
    • HOX A1 homeodomain protein
    • HOX1
    • HOX1F
    • hoxa1
    • hoxb1b
    • HXA1_HUMAN
    • Lab like protein
    • MGC45232
    see all
  • FunctionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments.
  • Involvement in diseaseAthabaskan brainstem dysgenesis syndrome
    Bosley-Salih-Alorainy syndrome
  • Sequence similaritiesBelongs to the Antp homeobox family. Labial subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HOXA1 protein images

  • 12.5% SDS-PAGE showing ab114878 at approximately 37.62kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HOXA1 protein (ab114878)

ab114878 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114878.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"