Recombinant Human HOXA13 protein (ab114544)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP31271
    • SpeciesHuman
    • SequenceDKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPG LGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL
    • Molecular weight37 kDa including tags
    • Amino acids208 to 306

Specifications

Our Abpromise guarantee covers the use of ab114544 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Homeo box 1J
    • Homeo box A13
    • Homeobox 1J
    • Homeobox A13
    • Homeobox protein Hox A13
    • Homeobox protein Hox-1J
    • Homeobox protein Hox-A13
    • Homeobox protein HOXA13
    • Homeobox1J
    • HomeoboxA13
    • HOX 1
    • HOX 1J
    • Hox 1J protein
    • HOX A13
    • HOX1
    • HOX1J
    • HOXA 13
    • HOXA13
    • HXA13_HUMAN
    • Transcription factor HOXA13
    see all
  • FunctionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Involvement in diseaseDefects in HOXA13 are the cause of hand-foot-genital syndrome (HFGS) [MIM:140000]; also known as hand-foot-uterus syndrome. The clinical features include small feet with unusually short great toes and abnormal thumbs. Females with the disorder have duplication of the genital tract.
    Defects in HOXA13 are the cause of Guttmacher syndrome (GUTTS) [MIM:176305]. Guttmacher syndrome is a dominantly inherited combination of distal limb and genital tract abnormalities. It has several features in common with hand-foot-genital syndrome, including hypoplastic first digits and hypospadias. Typical features not seen in hand-foot-genital syndrome include postaxial polydactyly of the hands and uniphalangeal second toes with absent nails.
  • Sequence similaritiesBelongs to the Abd-B homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HOXA13 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114544.

References for Recombinant Human HOXA13 protein (ab114544)

ab114544 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114544.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"