Overview

  • Product name
    Recombinant Human HOXA5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSY AASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSD
    • Molecular weight
      36 kDa including tags
    • Amino acids
      24 to 113

Specifications

Our Abpromise guarantee covers the use of ab114634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homeo box 1C
    • Homeo box A5
    • Homeobox A5
    • Homeobox protein Hox-1C
    • Homeobox protein Hox-A5
    • Homeobox protein HOXA5
    • HOX 1
    • HOX 1.3
    • HOX 1C
    • HOX1
    • HOX1.3
    • HOX1C
    • HOXA5
    • HXA5_HUMAN
    • MGC9376
    • OTTHUMP00000217259
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-CYYNATTA[TG]Y-3'.
  • Sequence similarities
    Belongs to the Antp homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    Expressed during embryogenesis and in adult kidney.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114634 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up