Recombinant Human HOXA9 protein (denatured) (ab180306)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMATTGALGNYYVDSFLLGADAADELSV GRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKATVFGASWNPVHAAGANA VPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSS RPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSE NNAENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLF NMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 272
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_689952

Specifications

Our Abpromise guarantee covers the use of ab180306 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names
    • ABD-B
    • Abd-B, drosophila, homolog of
    • D6a9
    • Homeobox 1G
    • Homeobox A9
    • Homeobox protein Hox-1.7
    • Homeobox protein Hox-1G
    • Homeobox protein Hox-A9
    • Homeodomain protein HOXA9
    • Hox-1.7
    • Hox-1.7, mouse, homolog of
    • HOX1
    • Hox1.7
    • Hox1G
    • Hox1r5
    • Hoxa-9
    • Hoxa7
    • HOXA9
    • HOXA9/MSI2 fusion gene, included
    • HOXA9/NUP98 fusion gene, included
    • HXA9_HUMAN
    • MGC1934
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Involvement in disease
    Note=A chromosomal aberration involving HOXA9 is found in a form of acute myeloid leukemia. Translocation t(7;11)(p15;p15) with NUP98.
    Note=A chromosomal aberration involving HOXA9 may contribute to disease progression in chronic myeloid leukemia. Translocation t(7;17)(p15;q23) with MSI2.
  • Sequence similarities
    Belongs to the Abd-B homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180306 (3 µg).

References

ab180306 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180306.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up