Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGG GLSSPAFQQNSGYPAQQPPSTLGV
    • Amino acids
      1 to 74
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HCFP3
    • Homeo box 2I
    • Homeo box B1
    • Homeobox 2I
    • Homeobox B1
    • Homeobox protein Hox B1
    • Homeobox protein Hox-2I
    • Homeobox protein Hox-B1
    • Homeobox protein HoxB1
    • Homeobox2I
    • HomeoboxB1
    • HOX 2
    • Hox 2.9
    • HOX 2I
    • HOX B1
    • HOX2
    • Hox2.9
    • HOX2I
    • HOXB 1
    • HOXB1
    • HOXB1 protein
    • HXB1_HUMAN
    • MGC116843
    • MGC116844
    • MGC116845
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
  • Sequence similarities
    Belongs to the Antp homeobox family. Labial subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158675 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up