Overview

  • Product nameRecombinant Human Hoxb3 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14651
    • SpeciesHuman
    • SequenceTAGFMNALHSMTPSYESPSPPAFGKAHQNAYALPSNYQPPLKGCGAPQKY PPTPAPEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPPAGPSL
    • Molecular weight37 kDa including tags
    • Amino acids272 to 370

Specifications

Our Abpromise guarantee covers the use of ab116945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homeo box 2G
    • Homeo box B3
    • Homeobox B3
    • Homeobox protein Hox-2.7
    • Homeobox protein Hox-2G
    • Homeobox protein Hox-B3
    • Homeobox protein HoxB3
    • Hox 2.7
    • HOX 2G
    • HOX2
    • Hox2.7
    • HOX2G
    • HOXB3
    • HXB3_HUMAN
    see all
  • FunctionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similaritiesBelongs to the Antp homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stageExpressed in whole embryos and fetuses at 5-9 weeks from conception.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Hoxb3 protein images

  • 12.5% SDS-PAGE showing ab116945 at approximately 36.52kDa stained with Coomassie Blue.

References for Recombinant Human Hoxb3 protein (ab116945)

ab116945 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116945.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"