Overview

  • Product name
    Recombinant Human HOXB4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQP EAGFGRRAACTVQRYAACRD
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 70

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114457 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114457 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Homeo box 2F
    • Homeo box B4
    • Homeobox 2F
    • Homeobox B4
    • Homeobox protein Hox B4
    • Homeobox protein Hox-2.6
    • Homeobox protein Hox-2F
    • Homeobox protein Hox-B4
    • Homeobox protein HoxB4
    • HOX 2
    • Hox 2.6
    • Hox 2F
    • HOX B4
    • HOX2
    • Hox2.6
    • Hox2F
    • HOXB 4
    • hoxb4
    • HXB4_HUMAN
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similarities
    Belongs to the Antp homeobox family. Deformed subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    Expressed in whole embryos and fetuses at 5-9 weeks from conception.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human HOXB4 protein images

  • ab114457 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human HOXB4 protein (ab114457)

ab114457 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114457.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up