Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09067
    • SpeciesHuman
    • SequenceEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYL TRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAF
    • Molecular weight36 kDa including tags
    • Amino acids170 to 267

Specifications

Our Abpromise guarantee covers the use of ab116878 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HGNC:5116
    • HHO.C10
    • Homeo box 2A
    • Homeo box B5
    • Homeobox 2A
    • Homeobox B5
    • Homeobox protein HHO.C10
    • Homeobox protein Hox B5
    • Homeobox protein Hox-2A
    • Homeobox protein Hox-B5
    • Homeobox protein HoxB5
    • Homeobox protein Hu-1
    • Homeobox2A
    • HomeoboxB5
    • HOX 2
    • Hox 2.1
    • HOX 2A
    • HOX B5
    • HOX2
    • Hox2.1
    • Hox2.1, mouse, homolog of
    • HOX2A
    • HOXB 5
    • Hoxb5
    • HU 1
    • HU1
    • HXB5_HUMAN
    see all
  • FunctionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Tissue specificitySpinal cord.
  • Sequence similaritiesBelongs to the Antp homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stageEmbryo.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HOXB5 protein images

  • 12.5% SDS-PAGE showing ab116878 at approximately 36.41kDa stained with Coomassie Blue.

References for Recombinant Human HOXB5 protein (ab116878)

ab116878 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116878.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"