Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRM KWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAE DITRL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      160 to 264

Specifications

Our Abpromise guarantee covers the use of ab116780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CP 19
    • CP19
    • Homeo box 3E
    • Homeo box C4
    • Homeo box protein HoxC4
    • Homeobox 3E
    • Homeobox C4
    • Homeobox protein CP19
    • Homeobox protein Hox C4
    • Homeobox protein Hox-3E
    • Homeobox protein Hox-C4
    • Homeobox protein HoxC4
    • Homeobox3E
    • HomeoboxC4
    • HOX 3
    • Hox 3E
    • HOX C4
    • HOX3
    • Hox3E
    • HOXC 4
    • Hoxc4
    • HXC4_HUMAN
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similarities
    Belongs to the Antp homeobox family. Deformed subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116780 at approximately 37.18kDa.
    Stained with Coomassie Blue.

References

ab116780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up