Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09017
    • SpeciesHuman
    • SequenceRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRM KWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAE DITRL
    • Molecular weight37 kDa including tags
    • Amino acids160 to 264

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CP 19
    • CP19
    • Homeo box 3E
    • Homeo box C4
    • Homeo box protein HoxC4
    • Homeobox 3E
    • Homeobox C4
    • Homeobox protein CP19
    • Homeobox protein Hox C4
    • Homeobox protein Hox-3E
    • Homeobox protein Hox-C4
    • Homeobox protein HoxC4
    • Homeobox3E
    • HomeoboxC4
    • HOX 3
    • Hox 3E
    • HOX C4
    • HOX3
    • Hox3E
    • HOXC 4
    • Hoxc4
    • HXC4_HUMAN
    see all
  • FunctionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similaritiesBelongs to the Antp homeobox family. Deformed subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HOXC4 protein images

  • 12.5% SDS-PAGE showing ab116780 at approximately 37.18kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HOXC4 protein (ab116780)

ab116780 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"