Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09630
    • SpeciesHuman
    • SequenceMNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIY STPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSI AQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSR YQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKES NLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE
    • Molecular weight52 kDa including tags
    • Amino acids1 to 235

Specifications

Our Abpromise guarantee covers the use of ab116795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CP25
    • HHO.C8
    • Homeo box 3C
    • Homeo box C6
    • Homeo box C8 protein
    • Homeobox C6
    • Homeobox protein CP25
    • Homeobox protein HHO.C8
    • Homeobox protein Hox-3C
    • Homeobox protein Hox-C6
    • HOX3
    • HOX3C
    • Hoxc6
    • HXC6_HUMAN
    see all
  • FunctionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similaritiesBelongs to the Antp homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HoxC6 protein images

  • 12.5% SDS-PAGE showing ab116795 at approximately 51.92kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HoxC6 protein (ab116795)

ab116795 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"