Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP31273
    • SpeciesHuman
    • SequencePGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPR QSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS
    • Molecular weight36 kDa including tags
    • Amino acids47 to 136

Specifications

Our Abpromise guarantee covers the use of ab114586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homeo box 3A
    • Homeo box 8
    • Homeobox 3A
    • Homeobox C8
    • Homeobox protein Hox C8
    • Homeobox protein Hox-3A
    • Homeobox protein Hox-C8
    • Homeobox protein HoxC8
    • Homeobox protein R4
    • Homolog of mouse Hox 3.1
    • HOX 3
    • Hox 3.1 mouse homolog of
    • HOX 3A
    • HOX C8
    • Hox-3.1
    • Hox-3A
    • HOX3
    • HOX3A
    • HOXC 8
    • Hoxc-8
    • HOXC8
    • HXC8_HUMAN
    • M31
    see all
  • FunctionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similaritiesBelongs to the Antp homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HOXC8 protein images

  • 12.5% SDS-PAGE showing ab114586 at approximately 35.53kDa stained with Coomassie Blue.

References for Recombinant Human HOXC8 protein (ab114586)

ab114586 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"