Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9GZZ0
    • SpeciesHuman
    • SequenceQVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPA AFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ
    • Molecular weight36 kDa including tags
    • Amino acids151 to 240

Specifications

Our Abpromise guarantee covers the use of ab117047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • homeo box 4G
    • homeo box D1
    • Homeobox protein Hox D1
    • Homeobox protein Hox-D1
    • Homeobox protein Hox-GG
    • HOX 4
    • HOX 4G
    • HOX D1
    • Hox-4.7
    • HOX4
    • Hox4.9
    • HOX4G
    • hoxd1
    • HXD1_HUMAN
    • OTTHUMP00000163336
    see all
  • FunctionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
  • Sequence similaritiesBelongs to the Antp homeobox family. Labial subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HOXD1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117047 at approximately 35.53 kDa.

References for Recombinant Human HOXD1 protein (ab117047)

ab117047 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"