Recombinant Human HOXD10 protein (ab114656)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQP VTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVEN
    • Molecular weight
      37 kDa including tags
    • Amino acids
      44 to 143

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI385591
    • AI874987
    • Homeo box 4D
    • Homeo box D10
    • Homeobox D10
    • Homeobox protein Hox-4D
    • Homeobox protein Hox-4E
    • Homeobox protein Hox-D10
    • Hox 4.4
    • Hox 4.5
    • Hox 4D
    • Hox 4E
    • Hox 5.3
    • HOX4D
    • HOX4E
    • HOXD10
    • HXD10
    • HXD10_HUMAN
    • OTTMUSP00000017845
    • RP23-313J15.9
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Tissue specificity
    Strongly expressed in the adult male and female urogenital tracts.
  • Involvement in disease
    Defects in HOXD10 are a cause of congenital vertical talus (CVT) [MIM:192950]; also known as rocker-bottom foot deformity or congenital convex pes valgus. CVT is a dislocation of the talonavicular joint, with rigid dorsal dislocation of the navicular over the neck of the talus. This condition is usually associated with multiple other congenital deformities and only rarely is an isolated deformity.
  • Sequence similarities
    Belongs to the Abd-B homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    Expressed in the developing limb buds.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114656 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up