Recombinant Human HOXD10 protein (ab114656)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP28358
    • SpeciesHuman
    • SequenceGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQP VTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVEN
    • Molecular weight37 kDa including tags
    • Amino acids44 to 143

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI385591
    • AI874987
    • Homeo box 4D
    • Homeo box D10
    • Homeobox D10
    • Homeobox protein Hox-4D
    • Homeobox protein Hox-4E
    • Homeobox protein Hox-D10
    • Hox 4.4
    • Hox 4.5
    • Hox 4D
    • Hox 4E
    • Hox 5.3
    • HOX4D
    • HOX4E
    • HOXD10
    • HXD10
    • HXD10_HUMAN
    • OTTMUSP00000017845
    • RP23-313J15.9
    see all
  • FunctionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Tissue specificityStrongly expressed in the adult male and female urogenital tracts.
  • Involvement in diseaseDefects in HOXD10 are a cause of congenital vertical talus (CVT) [MIM:192950]; also known as rocker-bottom foot deformity or congenital convex pes valgus. CVT is a dislocation of the talonavicular joint, with rigid dorsal dislocation of the navicular over the neck of the talus. This condition is usually associated with multiple other congenital deformities and only rarely is an isolated deformity.
  • Sequence similaritiesBelongs to the Abd-B homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stageExpressed in the developing limb buds.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HOXD10 protein images

  • ab114656 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human HOXD10 protein (ab114656)

ab114656 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"