Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPG LYPRPDFGEQPF
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 62

Specifications

Our Abpromise guarantee covers the use of ab116808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • HHO.C13
    • homeo box D4
    • homeobox D4
    • Homeobox protein HHO.C13
    • Homeobox protein Hox-4B
    • Homeobox protein Hox-5.1
    • Homeobox protein Hox-D4
    • Hox-4.2
    • Hox-4.2, mouse, homolog of homeo box X
    • HOX-5.1
    • HOX4
    • HOX4B
    • HOXD4
    • HXD4_HUMAN
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similarities
    Belongs to the Antp homeobox family. Deformed subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human HOXD4 protein images

  • 12.5% SDS-PAGE showing ab116808 at approximately 32.45kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HOXD4 protein (ab116808)

ab116808 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up