Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDH LNQSSSPSQMFPWMR
    • Molecular weight
      33 kDa including tags
    • Amino acids
      126 to 190

Specifications

Our Abpromise guarantee covers the use of ab116896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • homeo box 4E
    • homeo box D8
    • Homeobox 4E
    • homeobox D8
    • homeobox protein 5.4
    • Homeobox protein Hox-4E
    • Homeobox protein Hox-5.4
    • Homeobox protein Hox-D8
    • Hox-4.5
    • Hox-4.5, mouse, homolog of
    • Hox-4E
    • Hox-5.4
    • HOX4
    • HOX4E
    • Hoxd8
    • HXD8_HUMAN
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similarities
    Belongs to the Antp homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human HOXD8 protein images

  • 12.5% SDS-PAGE showing ab116896 at approximately 32.78kDa and stained with Coomassie Blue.

References for Recombinant Human HOXD8 protein (ab116896)

ab116896 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up