Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDH LNQSSSPSQMFPWMR
    • Molecular weight
      33 kDa including tags
    • Amino acids
      126 to 190

Specifications

Our Abpromise guarantee covers the use of ab116896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • homeo box 4E
    • homeo box D8
    • Homeobox 4E
    • homeobox D8
    • homeobox protein 5.4
    • Homeobox protein Hox-4E
    • Homeobox protein Hox-5.4
    • Homeobox protein Hox-D8
    • Hox-4.5
    • Hox-4.5, mouse, homolog of
    • Hox-4E
    • Hox-5.4
    • HOX4
    • HOX4E
    • Hoxd8
    • HXD8_HUMAN
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similarities
    Belongs to the Antp homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116896 at approximately 32.78kDa and stained with Coomassie Blue.

References

ab116896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up