Recombinant Human HP1BP3 protein (ab162358)

Overview

  • Product name
    Recombinant Human HP1BP3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATDTSQGELVHPKALPLIVGAQLIHADKLGEKVEDSTMPIRRTVNSTRE TPPKSKLAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPKGEP ENEEKEENKSSEETKKDEKDQSKEKEKKVKKTIPSWATLSASQLARAQKQ TPMASSPRPKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRG YLLKQALKRELNRGVIKQVKGKGASGSFVVVQKSRKTPQKSRNRKNRSSA VDPEPQVKLEDVLPLAFTRLCEPKEASYSLIRKYVSQYYPKLRVDIRPQL LKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAI AAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWMEQI SGKGFSGTFQLCFPYYPSPGVLFPKKEPDDSRDEDEDEDESSEEDSEDEE PPPKRRLQKKTPAKSPGKAASVKQRGSKPAPKVSAAQRGKARPLPKKAPP KAKTPAKKTRPSSTVIKKPSGGSSKKPATSARKEVKLPGKGKSTMKKSFR VKK
    • Amino acids
      1 to 553
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Heterochromatin protein 1, binding protein 3
    • Heterochromatin protein 1-binding protein 3
    • HP1 BP74
    • HP1B3_HUMAN
    • HP1BP 3
    • HP1BP3
    • MGC28927
    • MGC43701
    • MGC72624
    • OTTHUMP00000002717
    • OTTHUMP00000002719
    • OTTHUMP00000002720
    • Protein HP1 BP74
    • Protein HP1-BP74
    • RP5 930J4.3
    see all
  • Function
    Component of heterochromatin that maintains heterochromatin integrity during G1/S progression and regulates the duration of G1 phase to critically influence cell proliferative capacity (PubMed:24830416). Mediates chromatin condensation during hypoxia, leading to increased tumor cell viability, radio-resistance, chemo-resistance and self-renewal(PubMed:25100860).
  • Sequence similarities
    Contains 3 H15 (linker histone H1/H5 globular) domains.
  • Domain
    A central region that included the first H15 (linker histone H1/H5 globular) domain binds at the entry/exit site of the nucleosomal DNA.
  • Cellular localization
    Nucleus. Chromosome. localized in nuclei but not in nucleoli in interphase. Colocalized with chromosomes in mitosis, with a gradually increased during G1 progression and a maximum level during late G1 phase (G1/S).
  • Information by UniProt

Images

  • ab162358 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up