Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGL ETGSREVVSHVIKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEV EDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVLQTYGDTTHTLVEKM NYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWY LKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKS QIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLR EKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEV IQRHNHQGFGAGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    purified by affinity chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • 4 HPPD
    • 4 hydroxyphenylpyruvate dioxygenase
    • 4 hydroxyphenylpyruvic acid oxidase
    • 4-hydroxyphenylpyruvate dioxygenase
    • 4-hydroxyphenylpyruvic acid oxidase
    • 4HPPD
    • GLOD3
    • glyoxalase domain containing 3
    • HPD
    • HPPD_HUMAN
    • HPPDase
    • PPD
    see all
  • FunctionKey enzyme in the degradation of tyrosine.
  • PathwayAmino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 3/6.
  • Involvement in diseaseTyrosinemia 3
    Hawkinsinuria
  • Sequence similaritiesBelongs to the 4HPPD family.
  • Information by UniProt

References for Recombinant Human HPD protein (ab88715)

ab88715 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"