Recombinant Human HPD protein (ab99868)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTTYSDKGAKPERGRFLHFHSVTFWVGNAK QAASFYCSKMGFEPLAYRGLETGSREVVSHVIKQGKIVFVLSSALNPWNK EMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGK VKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEM IDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVA NYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRH LRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKG YLLQIFTKPVQDRPTLFLEVIQRHNHQGFGAGNFNSLFKAFEEEQNLRGN LTNMETNGVVPGM
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 393
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99868 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 4 HPPD
    • 4 hydroxyphenylpyruvate dioxygenase
    • 4 hydroxyphenylpyruvic acid oxidase
    • 4-hydroxyphenylpyruvate dioxygenase
    • 4-hydroxyphenylpyruvic acid oxidase
    • 4HPPD
    • GLOD3
    • glyoxalase domain containing 3
    • HPD
    • HPPD_HUMAN
    • HPPDase
    • PPD
    see all
  • Function
    Key enzyme in the degradation of tyrosine.
  • Pathway
    Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 3/6.
  • Involvement in disease
    Tyrosinemia 3
    Hawkinsinuria
  • Sequence similarities
    Belongs to the 4HPPD family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99868 (3µg).

References

ab99868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
ELISA
I used ab99868 with two Ab antibodies Ab93138 and Ab93139 and neither antibodies were able to detect this antigen.
Username

Kamran Ghoreishi

Verified customer

Submitted Sep 12 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up