Overview

  • Product name
    Recombinant Human HPS5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYVSSEHKGRRVTALCWDTAILRVFVGDHAGKVSAIKLNTSKQAKAAAAF VMFPVQTITTVDSCVVQLDYLDGRLLISSLTRSFLCDTEREKFWKIGNKE RDGEYGACFFPGRCSGGQQPLIYCARPGSRMWEVNFDGEVISTHQFKKLL SLPPLPVITLRSEPQYDHTAGSSQSLSFPKLLHLSEHCVLTWTERGIYIF IPQNVQVLLWSEVKDIQDVAVCRNELFCLHLNGKVSHLSLISVERCVERL LRRGLWNLAARTCCLFQNSVIASRARKTLTADKLEHLKSQLDHGTYNDLI SQLEELILKFEPLDSACSSRRSSISSHESFSILDSGIYRIISSRRGSQSD EDSCSLHSQTLSEDERFKEFTSQQEEDLPDQCCGSHGNEDNVSHAPVMFE TDKNETFLPFGIPLPFRSPSPLVSLQAVKESVSSFVRKTTEKIGTLHTSP DLKVRPELRGDEQSCEEDVSSDTCPKEEDTEEEKEVTSPPPEEDRFQELK VATAEAMTKLQDPLVLFESESLRMVLQEWLSHLEKTFAMKDFSGVSDTDN SSMKLNQDVLLVNESKKGILDEDNEKEKRDSLGNEESVDKTACECVRSPR ESLDDLFQICSPCAIASGLRNDLAELTTLCLELNVLNSKIKSTSGHVDHT LQQYSPEILACQFLKKYFFLLNLKRAKESIKLSYSNSPSVWDTFIEGLKE MASSNPVYMEMEKGDLPTRLKLLDDEVPFDSPLLVVYATRLYEKFGESAL RSLIKFFPSILPSDIIQLCHHHPAEFLAYLDSLVKSRPEDQRSSFLESLL QPESLRLDWLLLAVSLDAPPSTSTMDDEGYPRPHSHLLSWGYSQLILHLI KLPADFITKEKMTDICRSCGFWPGYLILCLELERRREAFTNIVYLNDMSL MKGDNGWIPETVEEWKLLLHLIQSKSTRPAPQESLNGSLSDGPSPINVEN VALLLAKAMGPDRAWSLLQECGLALELSEKFTRTCDILRIAEKRQRALIQ SMLEKCDRFLWSQQA
    • Amino acids
      1 to 1015
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AIBP63
    • Alpha integrin binding protein 63
    • BLOC2S2
    • Hermansky Pudlak syndrome 5 protein
    • HPS5, biogenesis of lysosomal organelles complex 2 subunit 2
    • Ru2
    • Ruby eye protein 2 homolog
    see all
  • Relevance
    HPS5 may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. HPS5 interacts with Hermansky-Pudlak syndrome 6 protein and may interact with the cytoplasmic domain of integrin alpha 3. Mutations in HPS5 gene are associated with Hermansky-Pudlak syndrome type 5. Multiple transcript variants encoding two distinct isoforms have been identified for this gene.

Images

  • ab161364 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161364 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161364.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up