Recombinant Human HRSP12 protein (ab101632)

Overview

  • Product name
    Recombinant Human HRSP12 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSSLIRRVISTAKAPGAIGPYSQAVLVDRT IYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAGCDFTNVVKTT VLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQG PLTTASL
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 137
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101632 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 14.5 kDa translational inhibitor protein
    • 2-iminobutanoate/2-iminopropanoate deaminase
    • Heat responsive protein 12
    • Heat-responsive protein 12
    • Hrsp12
    • p14.5
    • Perchloric acid soluble protein
    • PSP
    • Reactive intermediate imine deaminase A homolog
    • Ribonuclease UK114
    • RIDA
    • Translational inhibitor p14.5
    • Translational inhibitor protein p14.5
    • UK114
    • UK114 antigen homolog
    • UK114_HUMAN
    see all
  • Function
    Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA.
  • Tissue specificity
    Hepatocytes and renal distal tubular epithelial cells. Only weak expression in other tissues.
  • Sequence similarities
    Belongs to the RutC family.
  • Developmental stage
    Up-regulated during cellular differentiation.
  • Cellular localization
    Cytoplasm. Nucleus. Mostly cytoplasmic but, in less differentiated cells occasionally nuclear.
  • Information by UniProt

Recombinant Human HRSP12 protein images

  • 15% SDS PAGE analysis of 3 µg ab101632.

References for Recombinant Human HRSP12 protein (ab101632)

ab101632 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up