Recombinant Human HRSP12 protein (ab101632)

Overview

  • Product nameRecombinant Human HRSP12 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP52758
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSSLIRRVISTAKAPGAIGPYSQAVLVDRT IYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAGCDFTNVVKTT VLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQG PLTTASL
    • Molecular weight17 kDa including tags
    • Amino acids1 to 137
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101632 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 14.5 kDa translational inhibitor protein
    • Heat responsive protein 12
    • Heat-responsive protein 12
    • Hrsp12
    • p14.5
    • Perchloric acid soluble protein
    • PSP
    • Ribonuclease UK114
    • Translational inhibitor p14.5
    • Translational inhibitor protein p14.5
    • UK114
    • UK114 antigen homolog
    • UK114_HUMAN
    see all
  • FunctionEndoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA.
  • Tissue specificityHepatocytes and renal distal tubular epithelial cells. Only weak expression in other tissues.
  • Sequence similaritiesBelongs to the RutC family.
  • Developmental stageUp-regulated during cellular differentiation.
  • Cellular localizationCytoplasm. Nucleus. Mostly cytoplasmic but, in less differentiated cells occasionally nuclear.
  • Information by UniProt

Recombinant Human HRSP12 protein images

  • 15% SDS PAGE analysis of 3 µg ab101632.

References for Recombinant Human HRSP12 protein (ab101632)

ab101632 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"