Recombinant Human HRSP12 protein (ab101632)

Overview

  • Product name
    Recombinant Human HRSP12 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSSLIRRVISTAKAPGAIGPYSQAVLVDRT IYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAGCDFTNVVKTT VLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQG PLTTASL
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 137
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101632 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 14.5 kDa translational inhibitor protein
    • 2-iminobutanoate/2-iminopropanoate deaminase
    • Heat responsive protein 12
    • Heat-responsive protein 12
    • Hrsp12
    • p14.5
    • Perchloric acid soluble protein
    • PSP
    • Reactive intermediate imine deaminase A homolog
    • Ribonuclease UK114
    • RIDA
    • Translational inhibitor p14.5
    • Translational inhibitor protein p14.5
    • UK114
    • UK114 antigen homolog
    • UK114_HUMAN
    see all
  • Function
    Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA.
  • Tissue specificity
    Hepatocytes and renal distal tubular epithelial cells. Only weak expression in other tissues.
  • Sequence similarities
    Belongs to the RutC family.
  • Developmental stage
    Up-regulated during cellular differentiation.
  • Cellular localization
    Cytoplasm. Nucleus. Mostly cytoplasmic but, in less differentiated cells occasionally nuclear.
  • Information by UniProt

Images

  • 15% SDS PAGE analysis of 3 µg ab101632.

References

ab101632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up