Recombinant Human HS1BP3 protein (ab163821)

Overview

  • Product name
    Recombinant Human HS1BP3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLA AFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFV GESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDS SVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEA LDPLGIMRLVSCC
    • Amino acids
      1 to 213
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ETM2
    • FLJ14249
    • H1BP3_HUMAN
    • HCLS1 binding protein 3
    • HCLS1-binding protein 3
    • HS1 binding protein 3
    • HS1 BP3
    • HS1-binding protein 3
    • Hs1bp3
    • HSP1BP-3
    see all
  • Function
    May be a modulator of IL-2 signaling.
  • Sequence similarities
    Contains 1 PX (phox homology) domain.
  • Information by UniProt

Images

  • ab163821 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up