Recombinant Human HS3ST1 protein (ab160739)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGS AQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGL GWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPS ERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHM QNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNK TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV GRTFDWH
    • Amino acids
      1 to 307
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-OST-1
    • 3OST
    • 3OST1
    • EC 2.8.2.23
    • h3 OST 1
    • h3-OST-1
    • Heparan sulfate (glucosamine) 3 O sulfotransferase 1
    • Heparan sulfate 3 O sulfotransferase 1
    • Heparan sulfate 3-O-sulfotransferase 1
    • Heparan sulfate D glucosaminyl 3 O sulfotransferase 1
    • Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1
    • Heparan sulfate glucosamine 3-O-sulfotransferase 1
    • Heparin glucosamine 3 O sulfotransferase
    • HS3S1_HUMAN
    • HS3ST 1
    • Hs3st1
    see all
  • Function
    Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site.
  • Tissue specificity
    Highly expressed in the brain and kidney and weakly expressed in the heart, lung and placenta.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family.
  • Cellular localization
    Golgi apparatus lumen.
  • Information by UniProt

Images

  • ab160739 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160739 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160739.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up