Recombinant Human HSD11B1 protein (ab114301)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREM AYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAE QFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVL TVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKE YSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGA LRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 292

Specifications

Our Abpromise guarantee covers the use of ab114301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 11 beta HSD 1
    • 11 beta HSD1
    • 11 beta hydroxysteroid dehydrogenase 1
    • 11 DH
    • 11-beta hydroxysteroid dehydrogenase, type 1
    • 11-beta-HSD1
    • 11-beta-hydroxysteroid dehydrogenase 1
    • 11-DH
    • 11DH
    • Corticosteroid 11 beta dehydrogenase isozyme 1
    • Corticosteroid 11-beta-dehydrogenase isozyme 1
    • CORTRD2
    • DHI1_HUMAN
    • HDL
    • HSD 11
    • HSD11
    • HSD11B
    • HSD11B1
    • HSD11L
    • Hydroxysteroid (11 beta) dehydrogenase
    • Hydroxysteroid (11 beta) dehydrogenase 1
    • MGC13539
    • SDR26C1
    • short chain dehydrogenase/reductase family 26C, member 1
    see all
  • Function
    Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.
  • Tissue specificity
    Widely expressed. Highest expression in liver.
  • Involvement in disease
    Defects in HSD11B1 are a cause of cortisone reductase deficiency (CRD) [MIM:604931]. In CRD, activation of cortisone to cortisol does not occur, resulting in adrenocorticotropin-mediated androgen excess and a phenotype resembling polycystic ovary syndrome (PCOS).
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human HSD11B1 protein images

  • 12.5% SDS-PAGE image showing ab114301 Stained with Coomassie Blue.

References for Recombinant Human HSD11B1 protein (ab114301)

ab114301 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up