Recombinant Human HSD11B1 protein (ab114301)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREM AYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAE QFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVL TVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKE YSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGA LRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 292

Specifications

Our Abpromise guarantee covers the use of ab114301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 11 beta HSD 1
    • 11 beta HSD1
    • 11 beta hydroxysteroid dehydrogenase 1
    • 11 DH
    • 11-beta hydroxysteroid dehydrogenase, type 1
    • 11-beta-HSD1
    • 11-beta-hydroxysteroid dehydrogenase 1
    • 11-DH
    • 11DH
    • Corticosteroid 11 beta dehydrogenase isozyme 1
    • Corticosteroid 11-beta-dehydrogenase isozyme 1
    • CORTRD2
    • DHI1_HUMAN
    • HDL
    • HSD 11
    • HSD11
    • HSD11B
    • HSD11B1
    • HSD11L
    • Hydroxysteroid (11 beta) dehydrogenase
    • Hydroxysteroid (11 beta) dehydrogenase 1
    • MGC13539
    • SDR26C1
    • short chain dehydrogenase/reductase family 26C, member 1
    see all
  • Function
    Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.
  • Tissue specificity
    Widely expressed. Highest expression in liver.
  • Involvement in disease
    Defects in HSD11B1 are a cause of cortisone reductase deficiency (CRD) [MIM:604931]. In CRD, activation of cortisone to cortisol does not occur, resulting in adrenocorticotropin-mediated androgen excess and a phenotype resembling polycystic ovary syndrome (PCOS).
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE image showing ab114301 Stained with Coomassie Blue.

References

ab114301 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up