Recombinant Human HSD11B2 protein (ab114569)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGH
    • Molecular weight
      37 kDa
    • Amino acids
      71 to 170

Specifications

Our Abpromise guarantee covers the use of ab114569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 11 beta HSD2
    • 11 beta hydroxysteroid dehydrogenase type 2
    • 11 DH2
    • 11-beta-HSD2
    • 11-beta-hydroxysteroid dehydrogenase type 2
    • 11-DH2
    • AME
    • AME1
    • Corticosteroid 11 beta dehydrogenase isozyme 2
    • Corticosteroid 11-beta-dehydrogenase isozyme 2
    • DHI2_HUMAN
    • HSD11B2
    • HSD11K
    • HSD2
    • Hydroxysteroid 11 beta dehydrogenase 2
    • Hydroxysteroid 11 beta dehydrogenase isoenzyme 2
    • NAD dependent 11 beta hydroxysteroid dehydrogenase
    • NAD-dependent 11-beta-hydroxysteroid dehydrogenase
    • SDR9C3
    • Short chain dehydrogenase/reductase family 9C, member 3
    see all
  • Function
    Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
  • Tissue specificity
    Found in placenta, kidney, pancreas, prostate, ovary, small intestine and colon.
  • Involvement in disease
    Defects in HSD11B2 are the cause of apparent mineralocorticoid excess (AME) [MIM:218030]. AME is a potentially fatal disease characterized by severe juvenile low-renin hypertension, sodium retention, hypokalemia and low levels of aldosterone. It often leads to nephrocalcinosis.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Microsome. Endoplasmic reticulum.
  • Information by UniProt

Recombinant Human HSD11B2 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human HSD11B2 protein (ab114569)

ab114569 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up