Recombinant Human HSD11B2 protein (ab114569)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP80365
    • SpeciesHuman
    • SequenceRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGH
    • Molecular weight37 kDa
    • Amino acids71 to 170

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 11 beta HSD2
    • 11 beta hydroxysteroid dehydrogenase type 2
    • 11 DH2
    • 11-beta-HSD2
    • 11-beta-hydroxysteroid dehydrogenase type 2
    • 11-DH2
    • AME
    • AME1
    • Corticosteroid 11 beta dehydrogenase isozyme 2
    • Corticosteroid 11-beta-dehydrogenase isozyme 2
    • DHI2_HUMAN
    • HSD11B2
    • HSD11K
    • HSD2
    • Hydroxysteroid 11 beta dehydrogenase 2
    • Hydroxysteroid 11 beta dehydrogenase isoenzyme 2
    • NAD dependent 11 beta hydroxysteroid dehydrogenase
    • NAD-dependent 11-beta-hydroxysteroid dehydrogenase
    • SDR9C3
    • Short chain dehydrogenase/reductase family 9C, member 3
    see all
  • FunctionCatalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
  • Tissue specificityFound in placenta, kidney, pancreas, prostate, ovary, small intestine and colon.
  • Involvement in diseaseDefects in HSD11B2 are the cause of apparent mineralocorticoid excess (AME) [MIM:218030]. AME is a potentially fatal disease characterized by severe juvenile low-renin hypertension, sodium retention, hypokalemia and low levels of aldosterone. It often leads to nephrocalcinosis.
  • Sequence similaritiesBelongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localizationMicrosome. Endoplasmic reticulum.
  • Information by UniProt

Recombinant Human HSD11B2 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human HSD11B2 protein (ab114569)

ab114569 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"