Recombinant Human HSD11B2 protein (ab114569)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGH
    • Molecular weight
      37 kDa
    • Amino acids
      71 to 170

Specifications

Our Abpromise guarantee covers the use of ab114569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 11 beta HSD2
    • 11 beta hydroxysteroid dehydrogenase type 2
    • 11 DH2
    • 11-beta-HSD2
    • 11-beta-hydroxysteroid dehydrogenase type 2
    • 11-DH2
    • AME
    • AME1
    • Corticosteroid 11 beta dehydrogenase isozyme 2
    • Corticosteroid 11-beta-dehydrogenase isozyme 2
    • DHI2_HUMAN
    • HSD11B2
    • HSD11K
    • HSD2
    • Hydroxysteroid 11 beta dehydrogenase 2
    • Hydroxysteroid 11 beta dehydrogenase isoenzyme 2
    • NAD dependent 11 beta hydroxysteroid dehydrogenase
    • NAD-dependent 11-beta-hydroxysteroid dehydrogenase
    • SDR9C3
    • Short chain dehydrogenase/reductase family 9C, member 3
    see all
  • Function
    Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
  • Tissue specificity
    Found in placenta, kidney, pancreas, prostate, ovary, small intestine and colon.
  • Involvement in disease
    Defects in HSD11B2 are the cause of apparent mineralocorticoid excess (AME) [MIM:218030]. AME is a potentially fatal disease characterized by severe juvenile low-renin hypertension, sodium retention, hypokalemia and low levels of aldosterone. It often leads to nephrocalcinosis.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Microsome. Endoplasmic reticulum.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114569 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up