Recombinant Human HSD17B1 protein (ab114763)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVA EVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF
    • Molecular weight
      36 kDa including tags
    • Amino acids
      189 to 285

Specifications

Our Abpromise guarantee covers the use of ab114763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 17 beta HSD 1
    • 17 beta hydroxysteroid dehydrogenase type 1
    • 17-beta-HSD 1
    • 17-beta-hydroxysteroid dehydrogenase type 1
    • 20 alpha-hydroxysteroid dehydrogenase
    • 20-alpha-HSD
    • DHB1_HUMAN
    • E17KSR
    • E2DH
    • EDH17B1
    • EDH17B2
    • EDHB17
    • Estradiol 17 beta dehydrogenase 1
    • Estradiol 17-beta-dehydrogenase 1
    • HSD17
    • HSD17B1
    • Hydroxysteroid (17 beta) dehydrogenase 1
    • MGC13814
    • Placental 17 beta hydroxysteroid dehydrogenase
    • Placental 17-beta-hydroxysteroid dehydrogenase
    • SDR28C1
    • Short chain dehydrogenase/reductase family 28CE,member 1
    see all
  • Function
    Favors the reduction of estrogens and androgens. Also has 20-alpha-HSD activity. Uses preferentially NADH.
  • Pathway
    Steroid biosynthesis; estrogen biosynthesis.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human HSD17B1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114763 at approximately 36.3kDa.

References for Recombinant Human HSD17B1 protein (ab114763)

ab114763 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up