Recombinant Human HSD17B1 protein (ab114763)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14061
    • SpeciesHuman
    • SequenceVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVA EVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF
    • Molecular weight36 kDa including tags
    • Amino acids189 to 285

Specifications

Our Abpromise guarantee covers the use of ab114763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 17 beta HSD 1
    • 17 beta hydroxysteroid dehydrogenase type 1
    • 17-beta-HSD 1
    • 17-beta-hydroxysteroid dehydrogenase type 1
    • 20 alpha-hydroxysteroid dehydrogenase
    • 20-alpha-HSD
    • DHB1_HUMAN
    • E17KSR
    • E2DH
    • EDH17B1
    • EDH17B2
    • EDHB17
    • Estradiol 17 beta dehydrogenase 1
    • Estradiol 17-beta-dehydrogenase 1
    • HSD17
    • HSD17B1
    • Hydroxysteroid (17 beta) dehydrogenase 1
    • MGC13814
    • Placental 17 beta hydroxysteroid dehydrogenase
    • Placental 17-beta-hydroxysteroid dehydrogenase
    • SDR28C1
    • Short chain dehydrogenase/reductase family 28CE,member 1
    see all
  • FunctionFavors the reduction of estrogens and androgens. Also has 20-alpha-HSD activity. Uses preferentially NADH.
  • PathwaySteroid biosynthesis; estrogen biosynthesis.
  • Sequence similaritiesBelongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human HSD17B1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114763 at approximately 36.3kDa.

References for Recombinant Human HSD17B1 protein (ab114763)

ab114763 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"