Recombinant Human Hsd17b11 protein (ab101826)

Overview

  • Product nameRecombinant Human Hsd17b11 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8NBQ5
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMESFVKLFIPKRRKSVTGEIVLITGAGHGI GRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNRE DIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAH FWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKT LTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMH GILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKI
    • Molecular weight31 kDa including tags
    • Amino acids20 to 285
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101826 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 17 beta HSD 11
    • 17 beta HSD XI
    • 17 BETA HSD11
    • 17 BETA HSDXI
    • 17 beta hydroxysteroid dehydrogenase 11
    • 17 beta hydroxysteroid dehydrogenase type XI
    • 17 beta hydroxysteroid dehydrogenase XI
    • 17-beta-HSD 11
    • 17-beta-HSD XI
    • 17-beta-hydroxysteroid dehydrogenase 11
    • 17-beta-hydroxysteroid dehydrogenase XI
    • 17betaHSD11
    • 17betaHSDXI
    • 17bHSD11
    • CTCL associated antigen HD CL 03
    • CTCL tumor antigen HD CL 03
    • CTCL-associated antigen HD-CL-03
    • Cutaneous T cell lymphoma associated antigen HD CL 03
    • Cutaneous T-cell lymphoma-associated antigen HD-CL-03
    • Dehydrogenase/reductase SDR family member 8
    • DHB11_HUMAN
    • DHRS8
    • Estradiol 17 beta dehydrogenase 11
    • Estradiol 17-beta-dehydrogenase 11
    • Hsd17b11
    • Hydroxysteroid (17 beta) dehydrogenase 11
    • PAN1B
    • Retinal short chain dehydrogenase/reductase 2
    • Retinal short-chain dehydrogenase/reductase 2
    • RETSDR2
    • SDR16C2
    • SDR2
    • Short chain dehydrogenase/reductase family 16C member 2
    • T cell lymphoma associated antigen HD CL 03
    see all
  • FunctionCan convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. Tumor-associated antigen in cutaneous T-cell lymphoma.
  • Tissue specificityPresent at high level in steroidogenic cells such as syncytiotrophoblasts, sebaceous gland, Leydig cells, and granulosa cells of the dominant follicle and corpus luteum. In lung, it is detected in the ciliated epithelium and in acini of adult trachea, in bronchioles, but not in alveoli. In the eye, it is detected in the nonpigmented epithelium of the ciliary body and, at lower level, in the inner nuclear layer of the retina (at protein level). Widely expressed. Highly expressed in retina, pancreas, kidney, liver, lung, adrenal, small intestine, ovary and heart.
  • Sequence similaritiesBelongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Hsd17b11 protein images

  • 15% SDS-PAGE analysis of 3µg ab101826

References for Recombinant Human Hsd17b11 protein (ab101826)

ab101826 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"