Recombinant Human HSD17B14 protein (ab101209)

Overview

  • Product nameRecombinant Human HSD17B14 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BPX1
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMATGTRYAGKVVVV TGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVT QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELN LLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAM TKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQP LGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVD APDIPS
    • Molecular weight32 kDa including tags
    • Amino acids1 to 270
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101209 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 17 beta HSD 14
    • 17 beta hydroxysteroid dehydrogenase 14
    • 17 beta hydroxysteroid dehydrogenase DHRS10
    • Dehydrogenase/reductase (SDR family) member 10
    • Dehydrogenase/reductase SDR family member 10
    • DHRS10
    • Hydroxysteroid (17 beta) dehydrogenase 14
    • Retinal short chain dehydrogenase/reductase 3
    • Retinal short chain dehydrogenase/reductase retSDR3
    • retSDR3
    • SDR3
    • SDR47C1
    • Short chain dehydrogenase/reductase family 47C, member 1
    see all
  • RelevanceHSD17B14 belongs to the short-chain dehydrogenases/reductases (SDR) family. It has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity and converts oestradiol to oestrone. The physiological substrate is not known. HSD17B14 acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro). It is highly expressed in brain, placenta, liver and kidney.
  • Cellular localizationCytoplasmic

Recombinant Human HSD17B14 protein images

  • 15% SDS-PAGE analysis of ab101209 (3 µg).

References for Recombinant Human HSD17B14 protein (ab101209)

ab101209 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101209.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"