Recombinant Human HSD17B14 protein (ab101209)

Overview

  • Product name
    Recombinant Human HSD17B14 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMATGTRYAGKVVVV TGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVT QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELN LLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAM TKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQP LGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVD APDIPS
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 306
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab101209 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 17 beta HSD 14
    • 17 beta hydroxysteroid dehydrogenase 14
    • 17 beta hydroxysteroid dehydrogenase DHRS10
    • Dehydrogenase/reductase (SDR family) member 10
    • Dehydrogenase/reductase SDR family member 10
    • DHRS10
    • Hydroxysteroid (17 beta) dehydrogenase 14
    • Retinal short chain dehydrogenase/reductase 3
    • Retinal short chain dehydrogenase/reductase retSDR3
    • retSDR3
    • SDR3
    • SDR47C1
    • Short chain dehydrogenase/reductase family 47C, member 1
    see all
  • Relevance
    HSD17B14 belongs to the short-chain dehydrogenases/reductases (SDR) family. It has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity and converts oestradiol to oestrone. The physiological substrate is not known. HSD17B14 acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro). It is highly expressed in brain, placenta, liver and kidney.
  • Cellular localization
    Cytoplasmic

Images

  • 15% SDS-PAGE analysis of ab101209 (3 µg).

References

ab101209 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101209.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up