Recombinant Human HSD17B2 protein (ab158705)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLL ILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCK YLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYS KVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVT KTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLEL SKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT
    • Amino acids
      1 to 387
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 17 beta HSD 2
    • 17-beta-HSD 2
    • 17-beta-hydroxysteroid dehydrogenase type 2
    • 20 alpha HSD
    • 20 alpha hydroxysteroid dehydrogenase
    • 20 alpha-hydroxysteroid dehydrogenase
    • 20-alpha-HSD
    • DHB2_HUMAN
    • E2DH
    • EDH17B2
    • Estradiol 17-beta-dehydrogenase 2
    • HSD17
    • Hsd17b2
    • Hydroxysteroid (17 beta) dehydrogenase 2
    • Microsomal 17 beta hydroxysteroid dehydrogenase
    • Microsomal 17-beta-hydroxysteroid dehydrogenase
    • SDR9C2
    • Short chain dehydrogenase/reductase family 9C, member 2
    • Testosterone 17 beta dehydrogenase
    • Testosterone 17-beta-dehydrogenase
    see all
  • Function
    Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158705 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up