Recombinant Human HSD17B6 protein (ab152898)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD ARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEH VGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLP LVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVK ISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIM KEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTS LADYILTRSWPKPAQAV
    • Amino acids
      1 to 317
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 17-beta-HSD 6
    • 17-beta-HSD6
    • 17-beta-hydroxysteroid dehydrogenase type 6
    • 3 hydroxysteroid epimerase
    • 3(alpha >beta) hydroxysteroid epimerase
    • 3(alpha >beta) hydroxysteroid epimerasel
    • 3-alpha->beta-HSE
    • 3-alpha->beta-hydroxysteroid epimerase
    • H17B6_HUMAN
    • HSD17B6
    • HSE
    • Hydroxysteroid (17 beta) dehydrogenase 6
    • Hydroxysteroid (17 beta) dehydrogenase 6 homolog (mouse)
    • Hydroxysteroid 17 beta dehydrogenase 6
    • NAD+ dependent 3 alpha hydroxysteroid dehydrogenase
    • NAD+ dependent 3 alpha hydroxysteroid dehydrogenase 3 hydroxysteroid epimerase
    • Oxidative 3 alpha hydroxysteroid dehydrogenase
    • Oxidative 3-alpha hydroxysteroid dehydrogenase
    • Oxidoreductase
    • Retinol dehydrogenase
    • RODH
    • SDR9C6
    • Short chain dehydrogenase/reductase family 9C, member 6
    see all
  • Function
    NAD-dependent oxidoreductase with broad substrate specificity that shows both oxidative and reductive activity (in vitro). Has 17-beta-hydroxysteroid dehydrogenase activity towards various steroids (in vitro). Converts 5-alpha-androstan-3-alpha,17-beta-diol to androsterone and estradiol to estrone (in vitro). Has 3-alpha-hydroxysteroid dehydrogenase activity towards androsterone (in vitro). Has retinol dehydrogenase activity towards all-trans-retinol (in vitro). Can convert androsterone to epi-androsterone. Androsterone is first oxidized to 5-alpha-androstane-3,17-dione and then reduced to epi-andosterone. Can act on both C-19 and C-21 3-alpha-hydroxysteroids.
  • Tissue specificity
    Detected in liver and prostate (at protein level). Detected in adult liver, lung, brain, placenta, prostate, adrenal gland, testis, mammary gland, spleen, spinal cord and uterus. Detected in caudate nucleus, and at lower levels in amygdala, corpus callosum, hippocampus, substantia nigra and thalamus. Detected in fetal lung, liver and brain.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Microsome membrane. Early endosome membrane.
  • Information by UniProt

Images

  • ab152898 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up