Overview

  • Product name
    Recombinant Human HSDL1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRL HFIPRLGSRADLIKQYGRWAVVSGATDGIGKAYAEELASRGLNIILISRN EEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGILVN NVGVFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAI VTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFY VATSMTAPSNFLHRCSWLVPSPKVYAHHAVSTLGISKRTTGYWSHSIQFL FAQYMPEWLWVWGANILNRSLRKEALCCTA
    • Amino acids
      1 to 330
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hsdl1
    • HSDL1_HUMAN
    • Hydroxysteroid dehydrogenase like 1
    • Hydroxysteroid dehydrogenase like protein 1
    • Inactive hydroxysteroid dehydrogenase-like protein 1
    • MGC125994
    • MGC125995
    • MGC126032
    • SDR12C3
    • Short chain dehydrogenase/reductase family 12C member 3
    • steroid dehydrogenase like
    see all
  • Tissue specificity
    Highly expressed in testis and ovary. Also detected in thyroid, spinal cord, adrenal gland, heart, placenta, skeletal muscle, small intestine, colon, spleen, prostate and pancreas.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab164424 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up