Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILP KYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQ DDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSEL KSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPL LLNTNGAQKKNLFQHIVKEPTDNHHHKVIF
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 230

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Heat shock factor protein 2
    • Heat shock transcription factor 2
    • HSF 2
    • HSF2
    • HSF2_HUMAN
    • HSTF 2
    see all
  • Function
    DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. In higher eukaryotes, HSF is unable to bind to the HSE unless the cells are heat shocked.
  • Sequence similarities
    Belongs to the HSF family.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasmic during normal growth and moves to the nucleus upon activation.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152461 stained with Coomassie Blue.

References

ab152461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up