Overview

  • Product nameRecombinant Human HSF4 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9ULV5
    • SpeciesHuman
    • SequenceKVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWR EVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC
    • Molecular weight37 kDa including tags
    • Amino acids120 to 219

Specifications

Our Abpromise guarantee covers the use of ab116999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Cataract, Marner
    • CTM
    • Heat shock factor protein 4
    • Heat shock transcription factor 4
    • hHSF4
    • HSF 4
    • HSF4
    • HSF4_HUMAN
    • HSTF 4
    see all
  • FunctionDNA-binding protein that specifically binds heat shock promoter elements (HSE). Isoform HSF4A represses transcription while the isoform HSF4B activates transcription.
  • Tissue specificityExpressed in heart, skeletal muscle, eye and brain, and at much lower levels in some other tissues.
  • Involvement in diseaseDefects in HSF4 are the cause of cataract zonular HSF4-related (CZ-HSF4) [MIM:116800]. A form of zonular cataract. Zonular or lamellar cataracts are opacities, broad or narrow, usually consisting of powdery white dots affecting only certain layers or zones between the cortex and nucleus of an otherwise clear lens. The opacity may be so dense as to render the entire central region of the lens completely opaque, or so translucent that vision is hardly if at all impeded. Zonular cataracts generally do not involve the embryonic nucleus, though sometimes they involve the fetal nucleus. Usually sharply separated from a clear cortex outside them, they may have projections from their outer edges known as riders or spokes.
    Defects in HSF4 are the cause of cataract Marner type (CAM) [MIM:116800]. A form of cataract with variable and progressive opacities. Affected individuals present with zonular cataract, although some have nuclear, anterior polar, or stellate cataract. Finger malformation is observed in some kindreds.
  • Sequence similaritiesBelongs to the HSF family.
  • Post-translational
    modifications
    Phosphorylated mainly on serine residues. Phosphorylation on Ser-298 promotes sumoylation on Lys-293.
    Isoform HSF4B is constitutively sumoylated. Sumoylation represses the transcriptional activity and is promoted by phosphorylation on Ser-298. HSFA is not sumoylated.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human HSF4 protein images

  • 12.5% SDS-PAGE showing ab116999 at approx. 36.63 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HSF4 protein (ab116999)

ab116999 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"