Recombinant Human HSFY1 protein (denatured) (ab174423)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAHVSSETQDVSPKDELTASEASTRSP LCEHTFPGDSDLRSMIEEHAFQVLSQGSLLESPSYTVCVSEPDKDDDFLS LNFPRKLWKIVESDQFKSISWDENGTCIVINEELFKKEILETKAPYRIFQ TDAIKSFVRQLNLYGFSKIQQNFQRSAFLATFLSEEKESSVLSKLKFYYN PNFKRGYPQLLVRVKRRIGVKNASPISTLFNEDFNKKHFRAGANMENHNS ALAAEASEESLFSASKNLNMPLTRESSVRQIIANSSVPIRSGFPPPSPST SVGPSEQIATDQHAILNQLTTIHMHSHSTYMQARGHIVNFITTTTSQYHI ISPLQNGYFGLTVEPSAVPTRYPLVSVNEAPYRNMLPAGNPWLQMPTIAD RSAAPHSRLALQPSPLDKYHPNYN
    • Molecular weight
      48 kDa including tags
    • Amino acids
      1 to 401
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NCBI Accession No.: NP_149099

Specifications

Our Abpromise guarantee covers the use of ab174423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • HSFY1
    • Heat shock transcription factor
    • Heat shock transcription factor 2-like protein
    • HSF2 like
    • HSF2-like
    • HSF2L
    • HSFY
    • HSFY1_HUMAN
    • HSFY2
    • Y-linked
    see all
  • Tissue specificity
    Testis-specific. Present in Sertoli cells and spermatogenic cells (at protein level).
  • Sequence similarities
    Belongs to the HSF family.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174423 (3 µg)

References

ab174423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up