Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEA YDVLSDPRKR EIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPH AMFAEFFGGRNPFDTFFGQRNG EEGMDIDDPFSGFPMGMGGFTNVNFG RSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTK KMKISHKRLNPDGK SIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKD KP HNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGM RRKVPGEG LPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
    • Amino acids
      2 to 340

Specifications

Our Abpromise guarantee covers the use of ab43613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 0.25mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • DnaJ (Hsp40) homolog subfmaily B member 1
    • DNAJ 1
    • DNAJ B1
    • DnaJ heat shock protein family (Hsp40) member B1
    • DnaJ homolog subfamily B member 1
    • DnaJ protein homolog 1
    • DNAJ1
    • DNAJB 1
    • Dnajb1
    • DNAJB1 protein
    • DNJB1_HUMAN
    • HDJ 1
    • HDJ-1
    • HDJ1
    • Heat shock 40 kDa protein 1
    • Heat shock 40kD protein 1
    • Heat shock protein 40
    • Hsp 40
    • HSP40
    • HSPF 1
    • HSPF1
    • Human DnaJ protein 1
    • Radial spoke 16 homolog B
    • RSPH16B
    • Sis1
    see all
  • Function
    Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP.
  • Sequence similarities
    Contains 1 J domain.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus > nucleolus. Translocates rapidly from the cytoplasm to the nucleus, and especially to the nucleoli, upon heat shock.
  • Information by UniProt

References

ab43613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab43613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up