Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEA YDVLSDPRKR EIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPH AMFAEFFGGRNPFDTFFGQRNG EEGMDIDDPFSGFPMGMGGFTNVNFG RSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTK KMKISHKRLNPDGK SIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKD KP HNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGM RRKVPGEG LPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
    • Amino acids2 to 340

Specifications

Our Abpromise guarantee covers the use of ab43613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 0.25mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • DnaJ (Hsp40) homolog subfmaily B member 1
    • DNAJ 1
    • DNAJ B1
    • DnaJ homolog subfamily B member 1
    • DnaJ protein homolog 1
    • DNAJ1
    • DNAJB 1
    • Dnajb1
    • DNAJB1 protein
    • DNJB1_HUMAN
    • HDJ 1
    • HDJ-1
    • HDJ1
    • Heat shock 40 kDa protein 1
    • Heat shock 40kD protein 1
    • Heat shock protein 40
    • Hsp 40
    • HSP40
    • HSPF 1
    • HSPF1
    • Human DnaJ protein 1
    • Radial spoke 16 homolog B
    • RSPH16B
    • Sis1
    see all
  • FunctionInteracts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP.
  • Sequence similaritiesContains 1 J domain.
  • Cellular localizationCytoplasm. Nucleus. Nucleus > nucleolus. Translocates rapidly from the cytoplasm to the nucleus, and especially to the nucleoli, upon heat shock.
  • Information by UniProt

References for Recombinant Human Hsp40 protein (ab43613)

ab43613 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab43613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"