Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENIL VSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSL SNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRS ALQSINEWAAQTTDGKLPEVTKDVERTDGALLVNAMFFKPHWDEKFHHKM VDNRGFMVTRSYTVGVMMMHRTGLYNYYDDEKEKLQIVEMPLAHKLSSLI ILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVAISLPKGVVEVTHDLQ KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQ DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL HHHHHH
    • Molecular weight
      45 kDa
    • Amino acids
      19 to 418
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Lyophilized from a 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • 47 kDa heat shock protein
    • 47 kDa heat shock protein precursor
    • Arsenic transactivated protein 3
    • Arsenic-transactivated protein 3
    • AsTP 3
    • AsTP3
    • CBP 1
    • CBP 2
    • CBP1
    • CBP2
    • Cell proliferation-inducing gene 14 protein
    • Collagen binding protein
    • Collagen binding protein 1
    • Collagen binding protein 2
    • Collagen-binding protein
    • Collagen-binding protein 2
    • Colligen
    • Colligin
    • Colligin 1
    • Colligin 2
    • colligin-1
    • colligin-2
    • gp46
    • Heat shock protein 47
    • Heat-shock protein 47
    • HGNC 1547
    • Hsp 47
    • J6
    • OI10
    • PIG 14
    • PIG14
    • PPROM
    • Proliferation inducing gene 14
    • Proliferation inducing gene 14 protein
    • RA A47
    • RA-A47
    • Rheumatoid arthritis antigen A 47
    • rheumatoid arthritis antigen A-47
    • Rheumatoid arthritis related antigen RA A47
    • Rheumatoid arthritis-related antigen RA-A47
    • serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
    • serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 2, (collagen-binding protein 2)
    • Serine or cysteine proteinase inhibitor clade H member 1
    • Serine or cysteine proteinase inhibitor clade H member 2
    • SERPH_HUMAN
    • Serpin H1
    • Serpin peptidase inhibitor clade H member 1
    • serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
    • Serpin peptidase inhibitor, clade H, member 1
    • SERPINH1
    • SERPINH2
    see all
  • Function
    Binds specifically to collagen. Could be involved as a chaperone in the biosynthetic pathway of collagen.
  • Involvement in disease
    Note=Defects in SERPINH1 may cause severe autosomal recessive osteogenesis imperfecta (OI). Osteogenesis imperfecta defines a group of connective tissue disorders characterized by bone fragility and low bone mass.
  • Sequence similarities
    Belongs to the serpin family.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

References

ab153788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up