Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENIL VSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSL SNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRS ALQSINEWAAQTTDGKLPEVTKDVERTDGALLVNAMFFKPHWDEKFHHKM VDNRGFMVTRSYTVGVMMMHRTGLYNYYDDEKEKLQIVEMPLAHKLSSLI ILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVAISLPKGVVEVTHDLQ KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQ DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
    • Molecular weight
      45 kDa including tags
    • Amino acids
      19 to 418
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Mature protein. NP_001226.

Specifications

Our Abpromise guarantee covers the use of ab182711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 85 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 50 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names
    • 47 kDa heat shock protein
    • 47 kDa heat shock protein precursor
    • Arsenic transactivated protein 3
    • Arsenic-transactivated protein 3
    • AsTP 3
    • AsTP3
    • CBP 1
    • CBP 2
    • CBP1
    • CBP2
    • Cell proliferation-inducing gene 14 protein
    • Collagen binding protein
    • Collagen binding protein 1
    • Collagen binding protein 2
    • Collagen-binding protein
    • Collagen-binding protein 2
    • Colligen
    • Colligin
    • Colligin 1
    • Colligin 2
    • colligin-1
    • colligin-2
    • gp46
    • Heat shock protein 47
    • Heat-shock protein 47
    • HGNC 1547
    • Hsp 47
    • J6
    • OI10
    • PIG 14
    • PIG14
    • PPROM
    • Proliferation inducing gene 14
    • Proliferation inducing gene 14 protein
    • RA A47
    • RA-A47
    • Rheumatoid arthritis antigen A 47
    • rheumatoid arthritis antigen A-47
    • Rheumatoid arthritis related antigen RA A47
    • Rheumatoid arthritis-related antigen RA-A47
    • serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
    • serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 2, (collagen-binding protein 2)
    • Serine or cysteine proteinase inhibitor clade H member 1
    • Serine or cysteine proteinase inhibitor clade H member 2
    • SERPH_HUMAN
    • Serpin H1
    • Serpin peptidase inhibitor clade H member 1
    • serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
    • Serpin peptidase inhibitor, clade H, member 1
    • SERPINH1
    • SERPINH2
    see all
  • Function
    Binds specifically to collagen. Could be involved as a chaperone in the biosynthetic pathway of collagen.
  • Involvement in disease
    Note=Defects in SERPINH1 may cause severe autosomal recessive osteogenesis imperfecta (OI). Osteogenesis imperfecta defines a group of connective tissue disorders characterized by bone fragility and low bone mass.
  • Sequence similarities
    Belongs to the serpin family.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • DTT-reduced (+) SDS-PAGE analysis of ab182711, staining overnight with Coomassie Blue.

References

ab182711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up