Recombinant Human Hsp90 alpha protein (ab191952)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVE KVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHL EINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTH ANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD
    • Molecular weight
      49 kDa including tags
    • Amino acids
      535 to 732
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      NP_005339.

Specifications

Our Abpromise guarantee covers the use of ab191952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 85 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 1.19% HEPES, 0.87% Sodium chloride, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • EL52
    • epididymis luminal secretory protein 52
    • Heat shock 86 kDa
    • heat shock 90kD protein 1, alpha
    • Heat shock 90kD protein 1, alpha like 4
    • heat shock 90kD protein, alpha-like 4
    • Heat shock 90kDa protein 1 alpha
    • Heat shock protein 90kDa alpha (cytosolic) class A member 1
    • Heat shock protein HSP 90-alpha
    • HS90A_HUMAN
    • HSP 86
    • HSP86
    • Hsp89
    • HSP89A
    • Hsp90
    • HSP90A
    • HSP90AA1
    • HSP90ALPHA
    • HSP90N
    • HSPC1
    • HSPCA
    • HSPCAL1
    • HSPCAL4
    • HSPN
    • LAP 2
    • LAP2
    • lipopolysaccharide-associated protein 2
    • LPS-associated protein 2
    • Renal carcinoma antigen NY-REN-38
    see all
  • Function
    Molecular chaperone. Has ATPase activity.
  • Sequence similarities
    Belongs to the heat shock protein 90 family.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localization
    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab191952 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 49 kDa.

References

ab191952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up