Recombinant human Hsp90 alpha protein (ab80369)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELIS NSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTK ADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTV ITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEE RRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEK ESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFD LFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISR EMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIH EDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKD QVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLE LPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKA EADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDE DDPTADDTSAAVTEEMPPLEGDDDTSRMEEVDHHHHHH
    • Molecular weight86 kDa including tags
    • Amino acids1 to 732
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab80369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific Activity : Kd of 8 nM. Assay conditions : 95 ul reaction mix (20 mM HEPES pH7.3, 50 mM KCl, 5 mM MgCl2, 20 mM Na2MoO4, 0.01% Triton X- 100, 100 ug/ml bovine serum albumin, 2 mM DTT, 0-30 nM Hsp90alpha) + 5 ul FITCgeldanamycin, incubate for 4 hrs at 4ºC. Fluorescent polarization measured at room temperature (lambda exc=485 nm, lambda em=528 nm).
  • Applications

    Functional Studies

    SDS-PAGE

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.05% Tween 20, 400mM Sodium chloride, 3mM DTT, 25mM Tris HCl, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • EL52
    • epididymis luminal secretory protein 52
    • Heat shock 86 kDa
    • heat shock 90kD protein 1, alpha
    • Heat shock 90kD protein 1, alpha like 4
    • heat shock 90kD protein, alpha-like 4
    • Heat shock 90kDa protein 1 alpha
    • Heat shock protein 90kDa alpha (cytosolic) class A member 1
    • Heat shock protein HSP 90-alpha
    • HS90A_HUMAN
    • HSP 86
    • HSP86
    • Hsp89
    • HSP89A
    • Hsp90
    • HSP90A
    • HSP90AA1
    • HSP90ALPHA
    • HSP90N
    • HSPC1
    • HSPCA
    • HSPCAL1
    • HSPCAL4
    • HSPN
    • LAP 2
    • LAP2
    • lipopolysaccharide-associated protein 2
    • LPS-associated protein 2
    • Renal carcinoma antigen NY-REN-38
    see all
  • FunctionMolecular chaperone. Has ATPase activity.
  • Sequence similaritiesBelongs to the heat shock protein 90 family.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localizationCytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Recombinant human Hsp90 alpha protein images

  • Image showing specific activity of ab80369.
  • 10% SDS-PAGE showing ab80369 at approximately 85.5kDa (4µg).

References for Recombinant human Hsp90 alpha protein (ab80369)

ab80369 has not yet been referenced specifically in any publications.

Product Wall

There are 2 main reasons provided by laboratory for loss of activity of this protein;

1. The 4C temperature is not ideal for this protein. It is a very sensitive to heat and should be stored at -80C. One should expect loss in activity when sto...

Read More

Thank you for contacting us.

The final concentration of FITC-labeled geldanamycin in the reaction mixture of the binding activity assay was 5 nM.

Thank you for contacting us.

The endotoxins has not been removed from this product and the amount also has not been determined yet so I am sorry I may not be helpful with this particular inquiry. I apologize for any inconvenience this may have...

Read More

Thank you for contacting us. The His tags for all four proteins you asked about are all 6X tags. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"