Recombinant Human HSPA1L protein (ab114801)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP34931
    • SpeciesHuman
    • SequenceMATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTE RLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEG GKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVPA YFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIF DLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRK HKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQR LLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAP LSLGLETAGGVMTALMKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERA MTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKV NKITIANDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFN MKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
    • Molecular weight97 kDa including tags
    • Amino acids1 to 641

Specifications

Our Abpromise guarantee covers the use of ab114801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Heat shock 70 kDa protein 1 Hom
    • Heat shock 70 kDa protein 1 like
    • Heat shock 70 kDa protein 1-Hom
    • Heat shock 70 kDa protein 1-like
    • Heat shock 70 kDa protein 1L
    • Heat shock 70kD protein like 1
    • HS71L_HUMAN
    • HSP70 1L
    • HSP70 HOM
    • HSP70-Hom
    • HSPA1L
    • hum70t
    • Spermatid specific heat shock protein 70
    see all
  • FunctionIn cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
  • Tissue specificityExpressed in spermatids.
  • Sequence similaritiesBelongs to the heat shock protein 70 family.
  • Information by UniProt

Recombinant Human HSPA1L protein images

  • ab114801 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human HSPA1L protein (ab114801)

ab114801 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"