Recombinant Human HSPB3 protein (denatured) (ab111632)

Overview

  • Product name
    Recombinant Human HSPB3 protein (denatured)
  • Protein length
    Full length protein
  • Description
    Recombinant Human HSPB3 protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAKIILRHLIEIPVRYQEEFEARGLEDCRL DHALYALPGPTIVDLRKTRAAQSPPVDSAAETPPREGKSHFQILLDVVQF LPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLS AVLCHDGILVVEVKDPVGTK
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 150
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 5% Glycerol, 6% Urea

General Info

  • Alternative names
    • 2310035K17Rik
    • AI844863
    • DHMN2C
    • Heat shock 17 kDa protein
    • Heat shock 27kD protein family, member 3;
    • Heat shock 27kDa protein 3
    • Heat shock protein 3
    • Heat shock protein beta 3
    • HMN2C
    • HSP 17
    • HSPL27
    • Protein 3
    • Small heat shock protein B3
    • spb3
    see all
  • Relevance
    Inhibitor of actin polymerization.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • 15% SDS-PAGE showing ab111632 at approximately 19.1kDa (3µg).

References

ab111632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up