Recombinant Human HSPB3 protein (denatured) (ab111632)

Overview

  • Product nameRecombinant Human HSPB3 protein (denatured)
  • Protein lengthFull length protein
  • Description
    Recombinant Human HSPB3 protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ12988
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAKIILRHLIEIPVRYQEEFEARGLEDCRL DHALYALPGPTIVDLRKTRAAQSPPVDSAAETPPREGKSHFQILLDVVQF LPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLS AVLCHDGILVVEVKDPVGTK
    • Molecular weight19 kDa including tags
    • Amino acids1 to 150
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 85 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 5% Glycerol, 6% Urea

General Info

  • Alternative names
    • 2310035K17Rik
    • AI844863
    • DHMN2C
    • Heat shock 17 kDa protein
    • Heat shock 27kD protein family, member 3;
    • Heat shock 27kDa protein 3
    • Heat shock protein 3
    • Heat shock protein beta 3
    • HMN2C
    • HSP 17
    • HSPL27
    • Protein 3
    • Small heat shock protein B3
    • spb3
    see all
  • RelevanceInhibitor of actin polymerization.
  • Cellular localizationCytoplasmic and Nuclear

Recombinant Human HSPB3 protein (denatured) images

  • 15% SDS-PAGE showing ab111632 at approximately 19.1kDa (3µg).

References for Recombinant Human HSPB3 protein (denatured) (ab111632)

ab111632 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"