Recombinant Human HSPBAP1 protein (ab107135)

Overview

  • Product nameRecombinant Human HSPBAP1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96EW2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAGSEATTPVIVAAGAGGEEGEHVKPFKP EKAKEIIMSLQQPAIFCNMVFDWPARHWNAKYLSQVLHGKQIRFRMGMKS MSTVPQFETTCNYVEATLEEFLTWNCDQSSISGPFRDYDHSKFWAYADYK YFVSLFEDKTDLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYG CNLVFQVQGRKRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNPDLKRF PQFRKAQRHAVTLSPGQVLFVPRHWWHYVESIDPVTVSINSWIELEEDHL ARVEEAITRMLVCALKTAENPQNTRAWLNPTEVEETSHAVNCCYLNAAVS AFFDRCRTSEVVEIQALRTDGEHMKKEELNVCNHMEVGQTGSQNLTTGTD KPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDKDGEHFGKLHC AKRQQIMSNSENAIEEQIASNTTTTPQTFISTDDLLDCLVNPQVTRIVAQ LLIQGRSL
    • Molecular weight57 kDa
    • Amino acids1 to 488
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 80 % SDS-PAGE.
    ab107135 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: PBS, pH 7.4

General Info

  • Alternative names
    • 27 KdA heat shock protein-associated protein 1
    • HBAP1_HUMAN
    • HSPB1-associated protein 1
    • HSPBAP1
    • PASS1
    • Protein associated with small stress protein 1
    • protein associating with small stress protein
    see all
  • FunctionMay play a role in cellular stress response.
  • Tissue specificityWidely expressed.
  • Involvement in diseaseNote=A chromosomal aberration involving HSPBAP1 has been found in a family with renal carcinoma. Translocation t(2;3)(q35;q21) with the putative pseudogene DIRC3. Produces an hybrid mRNA encoding a truncated HSPBAP1 lacking the first 36 amino acids.
  • Sequence similaritiesContains 1 JmjC domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human HSPBAP1 protein images

  • 15% SDS-PAGE showing ab107135 (3µg).

References for Recombinant Human HSPBAP1 protein (ab107135)

ab107135 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"