Recombinant Human HSPBAP1 protein (ab107135)

Overview

  • Product name
    Recombinant Human HSPBAP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAAGSEATTPVIVAAGAGGEEGEHVKPFKP EKAKEIIMSLQQPAIFCNMVFDWPARHWNAKYLSQVLHGKQIRFRMGMKS MSTVPQFETTCNYVEATLEEFLTWNCDQSSISGPFRDYDHSKFWAYADYK YFVSLFEDKTDLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYG CNLVFQVQGRKRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNPDLKRF PQFRKAQRHAVTLSPGQVLFVPRHWWHYVESIDPVTVSINSWIELEEDHL ARVEEAITRMLVCALKTAENPQNTRAWLNPTEVEETSHAVNCCYLNAAVS AFFDRCRTSEVVEIQALRTDGEHMKKEELNVCNHMEVGQTGSQNLTTGTD KPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDKDGEHFGKLHC AKRQQIMSNSENAIEEQIASNTTTTPQTFISTDDLLDCLVNPQVTRIVAQ LLIQGRSL
    • Molecular weight
      57 kDa
    • Amino acids
      1 to 488
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    ab107135 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: PBS, pH 7.4

General Info

  • Alternative names
    • 27 KdA heat shock protein-associated protein 1
    • HBAP1_HUMAN
    • HSPB1-associated protein 1
    • HSPBAP1
    • PASS1
    • Protein associated with small stress protein 1
    • protein associating with small stress protein
    see all
  • Function
    May play a role in cellular stress response.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Note=A chromosomal aberration involving HSPBAP1 has been found in a family with renal carcinoma. Translocation t(2;3)(q35;q21) with the putative pseudogene DIRC3. Produces an hybrid mRNA encoding a truncated HSPBAP1 lacking the first 36 amino acids.
  • Sequence similarities
    Contains 1 JmjC domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107135 (3µg).

References

ab107135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up