Recombinant Human HSPC152 protein (ab162578)

Overview

  • Product name
    Recombinant Human HSPC152 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVE WSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQC PESGRMFPISRGIPNMLLSEEETES
    • Amino acids
      1 to 125
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162578 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HSPC152
    • HSPC170
    • HSPC170 protein
    • Hypothetical protein HSPC152
    • Hypothetical protein LOC51504
    • TR112_HUMAN
    • TRM112
    • TRM112 like protein
    • TRM112-like protein
    • TRMT11 2
    • Trmt112
    • tRNA methyltransferase 11-2 homolog (S. cerevisiae)
    • tRNA methyltransferase 112 homolog
    see all
  • Function
    Participates both in methylation of protein and tRNA species. The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species.
  • Sequence similarities
    Belongs to the TRM112 family.
    Contains 1 TRM112 domain.
  • Information by UniProt

Images

  • ab162578 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162578 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162578.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up