Recombinant Human HSPC210 protein (ab105621)

Overview

  • Product name
    Recombinant Human HSPC210 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMETDCNPMELSSMSGFEEGSELNGFEGTDM KDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLEL TEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRL EALKRDGQS
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 139
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab105621 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C14ORF129
    • Chromosome 14 open reading frame 129
    • GSK3-beta interaction protein
    • GSK3beta interaction protein
    • GSKIP
    • GSKIP_HUMAN
    • MGC4945
    • UPF0279
    see all
  • Tissue specificity
    Detected in heart, brain, placenta, liver, skeletal muscle, kidney, testis, lung and pancreas.
  • Sequence similarities
    Belongs to the UPF0279 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab105621 (3µg)

References

ab105621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up