Recombinant Human HSPC210 protein (ab105621)

Overview

  • Product nameRecombinant Human HSPC210 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9P0R6
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMETDCNPMELSSMSGFEEGSELNGFEGTDM KDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLEL TEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRL EALKRDGQS
    • Molecular weight18 kDa including tags
    • Amino acids1 to 139
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab105621 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C14ORF129
    • Chromosome 14 open reading frame 129
    • GSK3-beta interaction protein
    • GSK3beta interaction protein
    • GSKIP
    • GSKIP_HUMAN
    • MGC4945
    • UPF0279
    see all
  • Tissue specificityDetected in heart, brain, placenta, liver, skeletal muscle, kidney, testis, lung and pancreas.
  • Sequence similaritiesBelongs to the UPF0279 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human HSPC210 protein images

  • 15% SDS-PAGE analysis of ab105621 (3µg)

References for Recombinant Human HSPC210 protein (ab105621)

ab105621 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"