Recombinant Human HSPC210 protein (ab105621)

Overview

  • Product name
    Recombinant Human HSPC210 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMETDCNPMELSSMSGFEEGSELNGFEGTDM KDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLEL TEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRL EALKRDGQS
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 139
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab105621 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C14ORF129
    • Chromosome 14 open reading frame 129
    • GSK3-beta interaction protein
    • GSK3beta interaction protein
    • GSKIP
    • GSKIP_HUMAN
    • MGC4945
    • UPF0279
    see all
  • Tissue specificity
    Detected in heart, brain, placenta, liver, skeletal muscle, kidney, testis, lung and pancreas.
  • Sequence similarities
    Belongs to the UPF0279 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human HSPC210 protein images

  • 15% SDS-PAGE analysis of ab105621 (3µg)

References for Recombinant Human HSPC210 protein (ab105621)

ab105621 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up