Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAP NSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDL LFSIAPEVVM
    • Amino acids
      344 to 453
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • High temperature requirement factor A3
    • High-temperature requirement factor A3
    • HtrA serine peptidase 3
    • HTRA3
    • HTRA3_HUMAN
    • Pregnancy related serine protease
    • Pregnancy-related serine protease
    • Probable serine protease HTRA3
    • PRSP
    • Serine protease HTRA3
    • Tasp
    see all
  • Function
    Probable serine protease.
  • Tissue specificity
    Widely expressed, with highest levels in both adult and fetal heart, ovary, uterus placenta, and bladder. Isoform 1 is predominant in heart and skeletal muscle, whereas isoform 2 is predominant in placenta and kidney.
  • Sequence similarities
    Belongs to the peptidase S1B family.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 Kazal-like domain.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab164959 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up