Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVS EDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNA ELPVLMLGRSSDLRAGEFVVALGSPFSLQNTATAGIVSTKQRGGKELGMK DSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGISFAIPSDRV RQFLAEYHEHQMKGKAFS
    • Molecular weight
      25 kDa including tags
    • Amino acids
      159 to 376
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Contains a catalytic domain (NM_153692).

Specifications

Our Abpromise guarantee covers the use of ab190385 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity
    > 80 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.02% Imidazole
    Constituents: 0.79% Tris HCl, 1.74% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • FLJ90724
    • High temperature requirement protean A4
    • High-temperature requirement factor A4
    • HTRA 4
    • HtrA serine peptidase 4
    • HTRA4
    • HTRA4_HUMAN
    • Probable serine protease HTRA4
    • Serine protease HTRA4
    see all
  • Function
    Serine protease.
  • Sequence similarities
    Belongs to the peptidase S1B family.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 Kazal-like domain.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab190385.

References

ab190385 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190385.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up