Overview

  • Product name
    Recombinant Human HUCE1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFEEPEWAEAAPVAAGLGPVISRPPPAASSQNKGSKRRQLLATLRALEAA SLSQHPPSLCISDSEEEEEERKKKCPKKASFASASAEVGKKGKKKCQKQG PPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHAPINSAQHLDN VDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKN KFQPPQVPDQAPAEAPTEKTEVSPVPRTDSHEARAGALRARMAQRLDGAR FRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIA RDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQV PLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDV RTFLRAVTKLGFKIVSKDLTNSHFFLFDFQKTGPPLVGPKAQLSGLQLQP CLYKRR
    • Amino acids
      1 to 456
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cerebral protein 1
    • hypothetical protein LOC23378
    • KIAA0409
    • NML
    • Nucleomethylin
    • Ribosomal RNA processing 8 methyltransferase homolog
    • Ribosomal RNA processing 8, methyltransferase, homolog (yeast)
    • Ribosomal RNA processing protein 8
    • Ribosomal RNA-processing protein 8
    • RRP 8
    • RRP8
    • RRP8 methyltransferase homolog
    • RRP8_HUMAN
    see all
  • Function
    Essential component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. In the complex, RRP8 binds to H3K9me2 and probably acts as a methyltransferase. Its substrates are however unknown.
  • Sequence similarities
    Belongs to the methyltransferase superfamily. RRP8 family.
  • Cellular localization
    Nucleus > nucleolus. Localizes at rDNA locus.
  • Information by UniProt

Images

  • ab161616 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up