Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGY RLGDRVLQVSFKTNKAHKS
    • Molecular weight
      33 kDa including tags
    • Amino acids
      312 to 380

Specifications

Our Abpromise guarantee covers the use of ab114734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ELAV (embryonic lethal abnormal vision Drosophila) like 4
    • ELAV L4
    • ELAV like 4
    • ELAV like protein 4
    • ELAV-like protein 4
    • ELAV4_HUMAN
    • Elavl4
    • Embryonic lethal abnormal vision Drosophila homolog of like 4
    • Hu antigen D
    • Hu-antigen D
    • HuD
    • Paraneoplastic encephalomyelitis antigen HuD
    • PNEM
    see all
  • Function
    May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR (By similarity). Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.
  • Tissue specificity
    Brain.
  • Sequence similarities
    Belongs to the RRM elav family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Methylation at Arg-243 by CARM1 weakens protective binding to the 3'-UTR of CDKN1A mRNA and down-regulates CDKN1A protein expression, thereby maintaining cells in a proliferative state. Methylation is inhibited by NGF, which facilitates neurite outgrowth.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114734 at approximately 33.22kDa.
    Stained with Coomassie Blue.

References

ab114734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up