Overview

  • Product name
    Recombinant Human HuD protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGY RLGDRVLQVSFKTNKAHKS
    • Molecular weight
      33 kDa including tags
    • Amino acids
      312 to 380

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ELAV (embryonic lethal abnormal vision Drosophila) like 4
    • ELAV L4
    • ELAV like 4
    • ELAV like protein 4
    • ELAV-like protein 4
    • ELAV4_HUMAN
    • Elavl4
    • Embryonic lethal abnormal vision Drosophila homolog of like 4
    • Hu antigen D
    • Hu-antigen D
    • HuD
    • Paraneoplastic encephalomyelitis antigen HuD
    • PNEM
    see all
  • Function
    May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR (By similarity). Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.
  • Tissue specificity
    Brain.
  • Sequence similarities
    Belongs to the RRM elav family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Methylation at Arg-243 by CARM1 weakens protective binding to the 3'-UTR of CDKN1A mRNA and down-regulates CDKN1A protein expression, thereby maintaining cells in a proliferative state. Methylation is inhibited by NGF, which facilitates neurite outgrowth.
  • Information by UniProt

Recombinant Human HuD protein images

  • 12.5% SDS-PAGE showing ab114734 at approximately 33.22kDa.
    Stained with Coomassie Blue.

References for Recombinant Human HuD protein (ab114734)

ab114734 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up