Recombinant Human Huntingtin Interacting Protein HIP1 (ab114964)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO00291
    • SpeciesHuman
    • SequenceMDRMASSMKQVPNPLPKVLSRRGVGAGLEAAERESFERTQTVSINKAINT QEVAVKEKHARTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKFCHVFH KLLRDGHPNVLKDSLRYRNELSDMSRMWGHLSEGYGQLCSIYLKLLRTKM EYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQ TVFNSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCL PADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQLPENPPNFLR ASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDI FGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQR VVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKA QRSLSEIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSMAR QAQVDLEREKKELEDSLERISDQGQRKTQEQLEVLESLKQELATSQRELQ VLQGSLETSAQSEANWAAEFAELEKERDSLVSGAAHREEELSALRKELQD TQLKLASTEESMCQLAKDQRKMLLVGSRKAAEQVIQDALNQLEEPPLISC AGSADHLLSTVTSISSCIEQLEKSWSQYLACPEDISGLLHSITLLAHLTS DAIAHGATTCLRAPPEPADSLTEACKQYGRETLAYLASLEEEGSLENADS TAMRNCLSKIKAIGEELLPRGLDIKQEELGDLVDKEMAATSAAIETATAR IEEMLSKSRAGDTGVKLEVNERILGCCTSLMQAIQVLIVASKDLQREIVE SGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRGKF EELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVV ASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQK LGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE
    • Molecular weight140 kDa including tags
    • Amino acids1 to 1037

Specifications

Our Abpromise guarantee covers the use of ab114964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2610109B09Rik
    • A930014B11Rik
    • E130315I21Rik
    • HIP 1
    • HIP I
    • HIP-1
    • HIP-I
    • hip1
    • HIP1/PDGFRB fusion gene
    • HIP1/PDGFRB fusion gene, included
    • HIP1_HUMAN
    • HIPI
    • Huntingtin interacting protein 1
    • Huntingtin-interacting protein 1
    • Huntingtin-interacting protein I
    • ILWEQ
    • KIAA4113
    • MGC126506
    • MGC27616
    • mKIAA4113
    see all
  • FunctionPlays a role in clathrin-mediated endocytosis and trafficking. Involved in regulating AMPA receptor trafficking in the central nervous system in an NMDA-dependent manner. Enhances androgen receptor (AR)-mediated transcription. May act as a proapoptotic protein that induces cell death by acting through the intrinsic apoptosis pathway. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis. May play a functional role in the cell filament networks. May be required for differentiation, proliferation, and/or survival of somatic and germline progenitors.
  • Tissue specificityUbiquitously expressed with the highest level in brain. Expression is up-regulated in prostate and colon cancer.
  • Involvement in diseaseNote=A chromosomal aberration involving HIP1 is found in a form of chronic myelomonocytic leukemia (CMML). Translocation t(5;7)(q33;q11.2) with PDGFRB. The chimeric HIP1-PDGFRB transcript results from an in-frame fusion of the two genes. The reciprocal PDGFRB-HIP1 transcript is not expressed.
  • Sequence similaritiesBelongs to the SLA2 family.
    Contains 1 ENTH (epsin N-terminal homology) domain.
    Contains 1 I/LWEQ domain.
  • DomainThe pseudo DED region (pDED) mediates the interaction with IFT57.
    Binds F-actin via the talin-like I/LWEQ domain.
  • Cellular localizationCytoplasm. Nucleus. Endomembrane system. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Shuttles between cytoplasm and nucleus. Nuclear translocation can be induced by AR.
  • Information by UniProt

Recombinant Human Huntingtin Interacting Protein HIP1 images

  • 12.5% SDS-PAGE showing ab114964 at approximately 140.14kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Huntingtin Interacting Protein HIP1 (ab114964)

ab114964 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"