Recombinant Human HUS1 protein (ab101944)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO60921
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMKFRAKIVDGACLNHFTRISNMIAKLAKTC TLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQMEGVSAENNEIY LELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVT HDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHL VIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHEDRNVEHMAEV HIDIRKLLQFLAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS
    • Molecular weight34 kDa including tags
    • Amino acids1 to 280
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101944 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • Checkpoint protein HUS1
    • hHUS1
    • Hus1
    • HUS1 (S. pombe) checkpoint homolog
    • HUS1 checkpoint homolog (S. pombe)
    • HUS1 Checkpoint Protein
    • HUS1 protein
    • HUS1+ - like protein
    • HUS1_HUMAN
    • Hydroxyurea-sensitive 1, S. pombe, homolog of
    see all
  • FunctionComponent of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the HUS1 family.
  • Cellular localizationNucleus. Cytoplasm. In discrete nuclear foci upon DNA damage. According to PubMed:14500360, localized also in the cytoplasm. DNA damage induces its nuclear translocation. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

Recombinant Human HUS1 protein images

  • 15% SDS-PAGE analysis of 3µg ab101944.

References for Recombinant Human HUS1 protein (ab101944)

ab101944 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us and I am sorry for the delay in getting back to you.

As mentioned in my previous email I have contacted the lab in regards to the HUS1 protein, ab101944 in order to try to understand why the results you have observe...

Read More

Thank you for your reply and for sharing that extra information.

From the details provided by the customer I cannot explain why they are not able to see the protein by SDS-PAGE when staining with the Coomassie stain. If they would like, I can ...

Read More

I am sorry for the delay in getting back to you. I now have further information to share with you from the lab in regards to the HUS1 protein (ab101944).

Following the concerns raised by you, the protein has been re-run on an SDS-PAGE gel to o...

Read More

Thank you for contacting us.

I am sorry to hear you are experiencing difficulties with one of our products. We take product complaints very seriously, and investigate every product that we feel may not be performing correctly.

In orde...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"